Cat. No.: IBDP-533002
Size:
Online InquiryTarget Information
Synonyms | Vasoactive Intestinal Peptide, guinea pig |
Sequence | HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 |
Function | VIP Guinea pig (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function. |
Product Details
Product Type | Peptide |
Cas | 96886-24-7 |
Molecular Weight | 3344.86 kDa |
Purity | 0.9835 |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |