Cat. No.: IBDP-532991
Size:
Online InquiryTarget Information
| Synonyms | Catostomus urotensin I |
| Sequence | NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 |
| Function | Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively. |
Product Details
| Product Type | Peptide |
| Cas | 83930-33-0 |
| Molecular Weight | 4869.46 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |