Cat. No.: IBDP-532933
Size:
Online InquiryTarget Information
| Synonyms | ALX-0600 TFA |
| Sequence | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Function | Teduglutide TFA is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide TFA is associated with trophic effects on gut mucosa. Teduglutide TFA can be used for the research of short bowel syndrome (SBS) and Crohn's disease (CD). |
Product Details
| Product Type | Peptide |
| Molecular Weight | 3866.15 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |