Cat. No.: IBDP-532920
Size:
Online InquiryTarget Information
| Sequence | YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL |
| Function | TAT-NSF700scr consists the intact TAT domain and glycine linker, followed by the NSF amino acids in a random order. TAT-NSF700scr is used as a control peptide that does not inhibit SNAREmediated exocytosis. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 4109.87 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |