Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

TAT-NSF700 Fusion Peptide

Cat. No.: IBDP-532919

Size:

Target Information

Sequence YGRKKRRQRRRGGGLLDYVPIGPRFSNLVLQALLVL
Function TAT-NSF700 Fusion Peptide is a potent N-ethyl-maleimide-sensitive factor (NSF) inhibitor. TAT-NSF700 Fusion Peptide can readily permeate the cell membrane and interact with the intracellular organelle directly.

Product Details

Product Type Peptide
Molecular Weight 4166.92 kDa

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.