Cat. No.: IBDP-532919
Size:
Online InquiryTarget Information
Sequence | YGRKKRRQRRRGGGLLDYVPIGPRFSNLVLQALLVL |
Function | TAT-NSF700 Fusion Peptide is a potent N-ethyl-maleimide-sensitive factor (NSF) inhibitor. TAT-NSF700 Fusion Peptide can readily permeate the cell membrane and interact with the intracellular organelle directly. |
Product Details
Product Type | Peptide |
Molecular Weight | 4166.92 kDa |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |