Cat. No.: IBDP-532918
Size:
Online InquiryTarget Information
| Sequence | YGRKKRRQRRRGGGENSFRFLADIFPAKAFPVRFE |
| Function | TAT-NSF222scr Fusion Polypeptide, scrambled is a control peptide of TAT-NSF700 Fusion Peptide (HY-P4113). TAT-NSF222scr Fusion Polypeptide, scrambled is consisted of the intact TAT domain followed by the amino acid residues of NSF 222-243 in a scrambled order. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 4214.80 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |