Cat. No.: IBDP-532917
Size:
Online InquiryTarget Information
| Sequence | YGRKKRRQRRRGGGLDKEFNSIFRRAFASRVFPPE |
| Function | TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocytosis, and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF). TAT-NSF222 Fusion Peptide is an exocytosis inhibitor. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 4239.81 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |