TAT-HA2 Fusion Peptide

Cat. No.: IBDI-438341

TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety.

Product Details

Target	Influenza Virus
Molecular Weight	3432.92
Appearance	Solid
Sequence	Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly
Sequence Shortening	RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
Purity	99.59%

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month
Handling	Sealed storage, away from moisture and light, under nitrogen
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.