Cat. No.: IBDP-532914
Size:
Online InquiryTarget Information
| Sequence | RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG |
| Function | TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety. |
Product Details
| Product Type | Peptide |
| Cas | 923954-79-4 |
| Molecular Weight | 3432.92 kDa |
| Purity | 0.9959 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |