Cat. No.: IBDP-532908
Size:
Online InquiryTarget Information
| Synonyms | TDE |
| Sequence | GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI |
| Function | TAT-DEF-Elk-1 (TDE) is a cell-penetrating peptide inhibitor of Elk-1, mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity. |
Product Details
| Product Type | Peptide |
| Cas | 1220751-16-5 |
| Molecular Weight | 3561.07 kDa |
| Purity | 0.9998 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |