Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Synthetic Human Macrophage Inflammatory Protein 3 alpha

Cat. No.: IBDP-530988

Size:

Target Information

Sequence ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCAN PKQTWVKYIVRLLSKKVKNM
Sequence Similarities Belongs to the intercrine beta (chemokine CC) family.
Amino Acids 27 to 96
Cellular Localization Secreted.
Tissue Specificity Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate, testis, small intestine and colon.
Function Chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Possesses antibacterial activity E.coli ATCC 25922 and S.aureus ATCC 29213.

Product Details

Product Type Protein
Species Human
Source Synthetic
Protein Length Full length protein
Molecular Weight 8 kDa
Purity >95%
Active No
Animal free Yes
Nature Synthetic
Application HPLC

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.