Super-TDU (1-31) (TFA)

Cat. No.: IBDI-438303

Super-TDU (1-31) TFA is a peptide fragment of Super-TDU. Super-TDU (1-31) TFA is an inhibitor of YAP-TEAD complex. Super-TDU TFA shows potent anti-tumor activity and suppresses tumor growth in gastric cancer mouse model.

Product Details

Target	YAP
Molecular Weight	3355.50
Appearance	Solid
Sequence Shortening	SVDDHFAKSLGDTWLQIGGSGNPKTANVPQT
Purity	99.56%

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month
Handling	Sealed storage, away from moisture and light
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.