Cat. No.: IBDP-532864
Size:
Online InquiryTarget Information
| Sequence | HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Function | (Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion. |
Product Details
| Product Type | Peptide |
| Cas | 215777-46-1 |
| Molecular Weight | 3313.63 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |