Cat. No.: IBDP-532861
Size:
Online InquiryTarget Information
| Sequence | TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ |
| Function | Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes. |
Product Details
| Product Type | Peptide |
| Cas | 149146-12-3 |
| Molecular Weight | 3651.95 kDa |
| Purity | 0.9978 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |