Cat. No.: IBDP-531296
Size:
Online InquiryTarget Information
| Sequence | IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGE KRCLNPESKAIKNLLKAVSKERSKRSP |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Amino Acids | 22 to 98 |
| Cellular Localization | Secreted. |
| Function | Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. |
Product Details
| Product Type | Protein |
| Species | Rhesus Monkey |
| Source | E. coli |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 9 kDa |
| Purity | >97% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |