Cat. No.: IBDP-530977
Size:
Online InquiryTarget Information
| Sequence | APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKA TELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTKDLISNINVIVLELKGS ETTLMCEYADETATIVEFLNRWITFCQSIISTLT |
| Sequence Similarities | Belongs to the IL-2 family. |
| Amino Acids | 21 to 154 |
| Cellular Localization | Secreted. |
| Function | Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. |
Product Details
| Product Type | Protein |
| Species | Rhesus Monkey |
| Source | E. coli |
| Tag | His |
| Protein Length | Full length protein |
| Molecular Weight | 36 kDa |
| Purity | >90% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |