Recombinant Rhesus Monkey IL-1 alpha Protein

Target Information

Sequence	SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDE AVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINK TITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSIT DFQILENQA
Sequence Similarities	Belongs to the IL-1 family.
Amino Acids	113 to 271
Cellular Localization	Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
Function	Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Product Details

Product Type	Protein
Species	Rhesus Monkey
Source	E. coli
Endotoxin Level	<1.0 Eu/µg
Protein Length	Full length protein
Molecular Weight	18 kDa
Purity	>97%
Active	Yes
Animal free	No
Nature	Recombinant
Application	FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.