Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Rhesus Monkey IL-1 alpha Protein

Cat. No.: IBDP-530869

Size:

Target Information

Sequence SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDE AVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINK TITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSIT DFQILENQA
Sequence Similarities Belongs to the IL-1 family.
Amino Acids 113 to 271
Cellular Localization Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
Function Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Product Details

Product Type Protein
Species Rhesus Monkey
Source E. coli
Endotoxin Level <1.0 Eu/µg
Protein Length Full length protein
Molecular Weight 18 kDa
Purity >97%
Active Yes
Animal free No
Nature Recombinant
Application FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.