Cat. No.: IBDP-532745
Size:
Online InquiryTarget Information
Synonyms | C-X-C motif chemokine 12|||Stromal cell-derived factor 1|||CXCL12|||SDF-1β |
Sequence | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNKRLKM |
Function | SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells. SDF-1 beta/CXCL12 Protein, Rat is produced in E. coli, and consists of 68 amino acids (K22-K89). |
Product Details
Product Type | Protein |
Species | Rat |
Source | E. coli |
Tag | Tag Free |
Endotoxin Level | <1.0 Eu/µg |
Molecular Weight | 8.4 kDa |
Purity | ≥95% |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |