Cat. No.: IBDP-530646
Size:
Online InquiryTarget Information
| Synonyms | rRtSCF|||Hematopoietic growth factor KL|||MGF|||Mast Cell Growth Factor |
| Sequence | QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
| Function | SCF Protein, Rat (HEK293) is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis. |
Product Details
| Product Type | Protein |
| Species | Rat |
| Source | HEK 293 Cells |
| Tag | Tag Free |
| Endotoxin Level | <0.2 Eu/μg |
| Molecular Weight | 10-24 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |