Cat. No.: IBDP-530646
Size:
Online InquiryTarget Information
Synonyms | rRtSCF|||Hematopoietic growth factor KL|||MGF|||Mast Cell Growth Factor |
Sequence | QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Function | SCF Protein, Rat (HEK293) is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis. |
Product Details
Product Type | Protein |
Species | Rat |
Source | HEK 293 Cells |
Tag | Tag Free |
Endotoxin Level | <0.2 Eu/μg |
Molecular Weight | 10-24 kDa |
Purity | ≥95% |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |