Recombinant Rat RANTES Protein

Target Information

Sequence	SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVC ANPEKKWVQEYINYLEMS
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	25 to 92
Cellular Localization	Secreted.
Tissue Specificity	T-cell and macrophage specific.
Function	Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.

Product Details

Product Type	Protein
Species	Rat
Source	E. coli
Protein Length	Full length protein
Molecular Weight	10 kDa
Purity	>98%
Active	Yes
Animal free	No
Nature	Recombinant

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.