Cat. No.: IBDP-530724
Size:
Online InquiryTarget Information
| Sequence | RSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNT SSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLN PDHREEETGRRRESGKKRK |
| Sequence Similarities | Belongs to the PDGF/VEGF growth factor family. |
| Amino Acids | 86 to 204 |
| Cellular Localization | Secreted. |
| Function | Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. Binding of this growth factor to its receptor elicits a variety of cellular responses. It is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound. |
Product Details
| Product Type | Protein |
| Species | Rat |
| Source | HEK 293 Cells |
| Protein Length | Protein fragment |
| Molecular Weight | 14 kDa |
| Purity | ≥95% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at Room Temperature. |
| Handling | Avoid freeze / thaw cycle. |