Cat. No.: IBDP-531499
Size:
Online InquiryTarget Information
| Sequence | QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVC AEAHQKWVEEAIAYLDMKTSTPKP |
| Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
| Amino Acids | 24 to 97 |
| Cellular Localization | Secreted. |
| Function | Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3. |
Product Details
| Product Type | Protein |
| Species | Rat |
| Source | E. coli |
| Protein Length | Full length protein |
| Molecular Weight | 9 kDa |
| Purity | >95% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |