Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Rat IL-4 Protein

Cat. No.: IBDP-530621

Size:

Target Information

Sequence CNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRV LRKFYFPRDVPPCLKNKSGVLGELRKLCRGVSGLNSLRSCTVNESTLTTL KDFLESLKSILRGKYLQSCTSMS
Sequence Similarities Belongs to the IL-4/IL-13 family.
Amino Acids 25 to 147
Cellular Localization Secreted.
Function Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.

Product Details

Product Type Protein
Species Rat
Source HEK 293 Cells
Endotoxin Level ≤0.005 Eu/µg
Protein Length Full length protein
Molecular Weight 14 kDa
Purity ≥95%
Active Yes
Animal free Yes
Nature Recombinant
Application FuncS, HPLC, MS, SDS-PAGE

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at Room Temperature.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.