Cat. No.: IBDP-530621
Size:
Online InquiryTarget Information
Sequence | CNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRV LRKFYFPRDVPPCLKNKSGVLGELRKLCRGVSGLNSLRSCTVNESTLTTL KDFLESLKSILRGKYLQSCTSMS |
Sequence Similarities | Belongs to the IL-4/IL-13 family. |
Amino Acids | 25 to 147 |
Cellular Localization | Secreted. |
Function | Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. |
Product Details
Product Type | Protein |
Species | Rat |
Source | HEK 293 Cells |
Endotoxin Level | ≤0.005 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 14 kDa |
Purity | ≥95% |
Active | Yes |
Animal free | Yes |
Nature | Recombinant |
Application | FuncS, HPLC, MS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at Room Temperature. |
Handling | Avoid freeze / thaw cycle. |