Cat. No.: IBDP-531061
Size:
Online InquiryTarget Information
| Synonyms | Glial cell line-derived neurotrophic factor|||ATF|||HFB1-GDNF|||HGDNF|||HSCR3 |
| Sequence | SPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI |
| Function | Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons. GDNF Protein, Rat (sf9, His) is produced in Sf9 insect cells with a N-Terminal His-tag. It consists of 134 amino acids (S78-I211). |
Product Details
| Product Type | Protein |
| Species | Rat |
| Source | Sf9 Insect Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 20 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |