Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Rat FGF2 Protein

Cat. No.: IBDP-530485

Size:

Target Information

Sequence MPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH VKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLES NNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Sequence Similarities Belongs to the heparin-binding growth factors family.
Amino Acids 9 to 154
Cellular Localization Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57.
Tissue Specificity Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
Function Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107).

Product Details

Product Type Protein
Species Rat
Source E. coli
Endotoxin Level ≤1.0 Eu/µg
Protein Length Full length protein
Molecular Weight 16 kDa
Purity >95%
Active Yes
Animal free Yes
Nature Recombinant
Application FuncS, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.