Cat. No.: IBDP-530311
Size:
Online InquiryTarget Information
Sequence | MANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALA VLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQ DMVLWKDVFRKNNQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQI LTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGIC ELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLV CPPNNQEVHHHHHH |
Sequence Similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily. Contains 1 protein kinase domain. |
Amino Acids | 67 to 323 |
Cellular Localization | Cytoplasm. Nucleus and Cell membrane. Cytoplasm, perinuclear region. Nucleus. Translocation to the nucleus requires endocytosis, probably endosomal sorting and is mediated by importin beta-1/KPNB1. |
Tissue Specificity | Expressed in a variety of tumor tissues including primary breast tumors and tumors from small bowel, esophagus, kidney and mouth. |
Function | Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization.In the nucleus is involved in transcriptional regulation. Associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. Implicated in transcriptional activation of CDKN1A; the function involves STAT3 and SRC. Involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth. |
Product Details
Product Type | Protein |
Species | Rat |
Source | E. coli |
Tag | His |
Endotoxin Level | <1.0 Eu/µg |
Protein Length | Protein fragment |
Molecular Weight | 29 kDa |
Purity | >95% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | HPLC, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |