Cat. No.: IBDP-530338
Size:
Online InquiryTarget Information
| Sequence | NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWW KLR |
| Sequence Similarities | Contains 9 EGF-like domains. Contains 9 LDL-receptor class B repeats. |
| Amino Acids | 974 to 1026 |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed in kidney, salivary gland, cerebrum and prostate. |
| Function | EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941). |
Product Details
| Product Type | Protein |
| Species | Rat |
| Source | HEK 293 Cells |
| Endotoxin Level | ≤0.005 Eu/µg |
| Protein Length | Protein fragment |
| Purity | ≥95% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | FuncS, HPLC, MS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at Room Temperature. |
| Handling | Avoid freeze / thaw cycle. |