Recombinant Rat CXCL5 Protein

Target Information

Sequence	APFSAMVATELRCVCLTLAPRINPKMIANLEVIPAGPHCPKVEVIAKLKN QKDNVCLDPQAPLIKKVIQKILGSENKKTKRNALALVRSASTQ
Sequence Similarities	Belongs to the intercrine alpha (chemokine CxC) family.
Cellular Localization	Secreted.
Function	Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.

Product Details

Product Type	Protein
Species	Rat
Source	E. coli
Protein Length	Full length protein
Molecular Weight	10 kDa
Purity	>97%
Active	Yes
Animal free	No
Nature	Recombinant
Application	FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.