Cat. No.: IBDP-531072
Size:
Online InquiryTarget Information
| Synonyms | rRtCXCL3|||C-X-C motif chemokine 3|||Cytokine-induced neutrophil chemoattractant 2|||CINC-2|||MIP2-alpha/beta |
| Sequence | RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS |
| Function | CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis. CXCL3 Protein, Rat (CHO) is produced in CHO cells, and consists of 68 amino acids (R33-S100). |
Product Details
| Product Type | Protein |
| Species | Rat |
| Source | CHO Cells |
| Tag | Tag Free |
| Endotoxin Level | <0.2 Eu/μg |
| Molecular Weight | 7.6 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |