Cat. No.: IBDP-530745
Size:
Online InquiryTarget Information
Sequence | VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEV CLNPEAPLVQRIVQKILNKGKAN |
Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
Amino Acids | 28 to 100 |
Cellular Localization | Secreted. |
Function | Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. |
Product Details
Product Type | Protein |
Species | Rat |
Source | E. coli |
Protein Length | Full length protein |
Molecular Weight | 8 kDa |
Purity | >98% |
Active | Yes |
Animal free | No |
Nature | Recombinant |
Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |