Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Rat CXCL2 Protein

Cat. No.: IBDP-530745

Size:

Target Information

Sequence VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEV CLNPEAPLVQRIVQKILNKGKAN
Sequence Similarities Belongs to the intercrine alpha (chemokine CxC) family.
Amino Acids 28 to 100
Cellular Localization Secreted.
Function Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.

Product Details

Product Type Protein
Species Rat
Source E. coli
Protein Length Full length protein
Molecular Weight 8 kDa
Purity >98%
Active Yes
Animal free No
Nature Recombinant
Application FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.