Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Rat CXCL10/IP10 Protein

Cat. No.: IBDP-530873

Size:

Target Information

Sequence IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNE KRCLNPESEAIKSLLKAVSQRRSKRAP
Sequence Similarities Belongs to the intercrine alpha (chemokine CxC) family.
Amino Acids 22 to 98
Cellular Localization Secreted.
Function Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Product Details

Product Type Protein
Species Rat
Source HEK 293 Cells
Endotoxin Level ≤0.005 Eu/µg
Protein Length Full length protein
Molecular Weight 9 kDa
Purity ≥95%
Active No
Animal free Yes
Nature Recombinant
Application HPLC, MS, SDS-PAGE

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at Room Temperature.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.