Cat. No.: IBDP-530873
Size:
Online InquiryTarget Information
Sequence | IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNE KRCLNPESEAIKSLLKAVSQRRSKRAP |
Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
Amino Acids | 22 to 98 |
Cellular Localization | Secreted. |
Function | Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. |
Product Details
Product Type | Protein |
Species | Rat |
Source | HEK 293 Cells |
Endotoxin Level | ≤0.005 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 9 kDa |
Purity | ≥95% |
Active | No |
Animal free | Yes |
Nature | Recombinant |
Application | HPLC, MS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at Room Temperature. |
Handling | Avoid freeze / thaw cycle. |