Cat. No.: IBDP-530710
Size:
Online InquiryTarget Information
Sequence | MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQ ATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKG SETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT |
Sequence Similarities | Belongs to the IL-2 family. |
Amino Acids | 21 to 154 |
Cellular Localization | Secreted. |
Function | Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. |
Product Details
Product Type | Protein |
Species | Pig |
Source | E. coli |
Endotoxin Level | ≤1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 15 kDa |
Purity | >95% |
Active | Yes |
Animal free | No |
Nature | Recombinant |
Application | FuncS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |