Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Pig IL-2 Protein

Cat. No.: IBDP-530710

Size:

Target Information

Sequence MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQ ATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKG SETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT
Sequence Similarities Belongs to the IL-2 family.
Amino Acids 21 to 154
Cellular Localization Secreted.
Function Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.

Product Details

Product Type Protein
Species Pig
Source E. coli
Endotoxin Level ≤1.0 Eu/µg
Protein Length Full length protein
Molecular Weight 15 kDa
Purity >95%
Active Yes
Animal free No
Nature Recombinant
Application FuncS, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.