Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse TSLPR Protein

Cat. No.: IBDP-532819

Size:

Target Information

Synonyms CRL2|||CRLF2|||CRL2 cytokine receptor|||cytokine receptor-like factor 2|||ILXR|||IL-XR|||P2RY8/CRLF2 fusion|||Thymic stromal lymphopoietin protein receptor|||Thymic stromal-derived lymphopoietin receptor|||TSLP receptor|||TSLPR
Sequence AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPPL

Product Details

Product Type Protein
Species Mouse
Source HEK 293 Cells
Tag hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 62-88 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.