Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse TIM-3/HAVCR2 Protein

Cat. No.: IBDP-531334

Size:

Target Information

Synonyms Havcr2|||Tim3|||Timd3|||Hepatitis A virus cellular receptor 2 homolog|||HAVcr-2|||T-cell immunoglobulin and mucin domain-containing protein 3|||TIMD-3|||T-cell immunoglobulin mucin receptor 3|||TIM-3|||T-cell membrane protein 3|||CD antigen CD366
Sequence RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR

Product Details

Product Type Protein
Species Mouse
Source HEK 293 Cells
Tag hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 50.0 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.