Cat. No.: IBDP-530713
Size:
Online InquiryTarget Information
| Synonyms | TGFB2|||BSC-1 cell growth inhibitor|||Cetermin|||Glioblastoma-derived T-cell suppressor factor|||G-TSF|||MGC116892|||Polyergin|||TGF-beta2|||TGF-beta-2|||transforming growth factor beta-2 |
| Sequence | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS |
| Function | Transforming growth factor-beta 2 (TGF-β2), an extracellular glycosylated protein, is a member of the TGF-β superfamily. TGFβ2 controls key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2). TGF-β2 is an immune suppressor involved in the development of immune tolerance, and also regulates embryonic development. TGF beta 2/TGFB2 Protein, Mouse/Rat (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A303-S414). |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | HEK 293 Cells |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 12.0 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |