Cat. No.: IBDP-530820
Size:
Online InquiryTarget Information
| Synonyms | C-X-C motif chemokine 12|||Stromal cell-derived factor 1|||CXCL12|||SDF-1β |
| Sequence | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM |
| Function | SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells. SDF-1 beta/CXCL12 Protein, Mouse is produced in E. coli, and consists of 72 amino acids (K22-M93). |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 10.74 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |