Cat. No.: IBDP-530818
Size:
Online InquiryTarget Information
| Synonyms | Cxcl12|||Stromal cell-derived factor 1|||SDF-1|||12-O-tetradecanoylphorbol 13-acetate repressed protein 1|||TPAR1|||C-X-C motif chemokine 12|||Pre-B cell growth-stimulating factor|||PBSF|||Thymic lymphoma cell-stimulating factor|||TLSF|||Sdf1 |
| Sequence | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Function | CXCL12 (stromal cell-derived factor-1, SDF-1) is a homeostatic chemokine that binds CXCR4 and CXCR7 receptors and physiologically functions in hematopoiesis, leucocyte trafficking, cardiogenesis, and neurogenesis. CXCL12 is constitutively expressed in several organs including lung, liver, skeletal muscle, brain, kidney, heart, skin, and bone marrow. CXCL12 has an essential role in neural and vascular development, hematopoiesis, cancer and in immunity. CXCL12 Protein, Mouse is produced in E. coli, and consists of 68 amino acids (K22-K89). |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 10.0 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |