Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse SCGB1A1 Protein

Cat. No.: IBDP-531050

Size:

Target Information

Synonyms Scgb1a1|||Cc10|||Ugb|||Utg|||Uteroglobin|||Clara cell 17 kDa protein|||Clara cell phospholipid-binding protein|||CCPBP|||Clara cells 10 kDa secretory protein|||CC10|||PCB-binding protein|||Secretoglobin family 1A member 1
Sequence DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Product Details

Product Type Protein
Species Mouse
Source E. coli
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 9 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.