Cat. No.: IBDP-530642
Size:
Online InquiryTarget Information
| Synonyms | rMuSCF|||Hematopoietic growth factor KL|||MGF|||Mast Cell Growth Factor |
| Sequence | MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
| Function | SCF Protein, Mouse (P.pastoris) is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | P. pastoris |
| Tag | Tag Free |
| Endotoxin Level | <0.2 Eu/μg |
| Molecular Weight | 18.4 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |