Recombinant Mouse SCDGFB/PDGF-D Protein

Target Information

Sequence	TPQRASIKALRNANLRRDESNHLTDLYQREENIQVTSNGHVQSPRFPNSY PRNLLLTWWLRSQEKTRIQLSFDHQFGLEEAENDICRYDFVEVEEVSESS TVVRGRWCGHKEIPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDF QPEAASETNWESVTSSFSGVSYHSPSITDPTLTADALDKTVAEFDTVEDL LKHFNPVSWQDDLENLYLDTPHYRGRSYHDRKSKVDLDRLNDDVKRYSCT PRNHSVNLREELKLTNAVFFPRCLLVQRCGGNCGCGTVNWKSCTCSSGKT VKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERCDCICSSRPPR
Sequence Similarities	Belongs to the PDGF/VEGF growth factor family. Contains 1 CUB domain.
Amino Acids	24 to 370
Cellular Localization	Secreted.
Tissue Specificity	Expressed at high levels in the heart, pancreas, adrenal gland and ovary and at low levels in placenta, liver, kidney, prostate, testis, small intestine, spleen and colon. In the kidney, expressed by the visceral epithelial cells of the glomeruli. A widespread expression is also seen in the medial smooth muscle cells of arteries and arterioles, as well as in smooth muscle cells of vasa rectae in the medullary area. Expressed in the adventitial connective tissue surrounding the suprarenal artery. In chronic obstructive nephropathy, a persistent expression is seen in glomerular visceral epithelial cells and vascular smooth muscle cells, as well as de novo expression by periglomerular interstitial cells and by some neointimal cells of arteriosclerotic vessels. Expression in normal prostate is seen preferentially in the mesenchyme of the gland while expression is increased and more profuse in prostate carcinoma. Expressed in many ovarian, lung, renal and brain cancer-derived cell lines.
Function	Potent mitogen for cells of mesenchymal origin. Binding of this growth factor to its affinity receptor elicits a variety of cellular responses. It is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound. Activated by proteolytic cleavage and this active form acts as a specific ligand for beta platelet-derived growth factor receptor. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis.

Product Details

Product Type	Protein
Species	Mouse
Source	E. coli
Tag	His
Protein Length	Full length protein
Molecular Weight	56 kDa
Purity	>90%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.