Cat. No.: IBDP-530748
Size:
Online InquiryTarget Information
| Synonyms | Ccl5|||Scya5C-C motif chemokine 5|||MuRantes|||SIS-delta|||Small-inducible cytokine A5|||T-cell-specific protein RANTES |
| Sequence | SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS |
| Function | RANTES/CCL5 Protein, Mouse is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Mouse is a recombinant mouse CCL5(S24-S91) protein expressed by E. coli. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 7.9 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |