Recombinant Mouse PLA2G5 Protein

Target Information

Sequence	GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRC YGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRR NLWTYNPLYQYYPNFLC
Sequence Similarities	Belongs to the phospholipase A2 family.
Amino Acids	21 to 137
Cellular Localization	Secreted.
Tissue Specificity	Heart, placenta and less abundantly, in lung.
Function	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.

Product Details

Product Type	Protein
Species	Mouse
Source	E. coli
Tag	His
Protein Length	Full length protein
Molecular Weight	16 kDa
Purity	>90%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.