Cat. No.: IBDP-530719
Size:
Online InquiryTarget Information
| Sequence | TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFD QANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC |
| Sequence Similarities | Belongs to the WD repeat PLAP family. Contains 6 ARM repeats. Contains 1 PFU domain. Contains 1 PUL domain. Contains 7 WD repeats. |
| Amino Acids | 495 to 584 |
| Function | Involved in the maintenance of ubiquitin levels. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | Mammalian |
| Tag | His |
| Protein Length | Protein fragment |
| Molecular Weight | 87 kDa |
| Purity | >85% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |