Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse NLRP3 Protein

Cat. No.: IBDP-531312

Size:

Target Information

Synonyms Nlrp3|||Cias1|||Mmig1|||Nalp3|||Pypaf1|||NACHT|||LRR and PYD domains-containing protein 3|||Cold autoinflammatory syndrome 1 protein homolog|||Cryopyrin|||Mast cell maturation-associated-inducible protein 1|||PYRIN-containing APAF1-like protein 1
Sequence MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR

Product Details

Product Type Protein
Species Mouse
Source E. coli
Tag SUMO, 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 35 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.