Cat. No.: IBDP-530601
Size:
Online InquiryTarget Information
| Synonyms | rMuC-X-C motif chemokine 9/CXCL9, His|||C-X-C motif chemokine 9|||Gamma-interferon-induced monokine|||Monokine induced by interferon-gamma|||MIG|||MuMIG|||Protein m119|||Small-inducible cytokine B9|||Cxcl9|||Mig|||Scyb9 |
| Sequence | TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT |
| Function | CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis. MIG/CXCL9 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 105amino acids (T22-T126). |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 18-25 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |