Cat. No.: IBDP-531566
Size:
Online InquiryTarget Information
Sequence | EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQG MSLCVDPTQKWVSEY MEILDQKSQILQPHHHHHH |
Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
Amino Acids | 20 to 97 |
Cellular Localization | Secreted. |
Tissue Specificity | Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate. |
Function | Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8. |
Product Details
Product Type | Protein |
Species | Mouse |
Source | Mammalian |
Tag | His |
Endotoxin Level | <1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 10 kDa |
Purity | >95% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |