Recombinant Mouse MCP1 Protein

Target Information

Sequence	QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKRE VCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKS EANASTTFSTTTSSTSVGVTSVTVN
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	24 to 148
Cellular Localization	Secreted.
Function	Chemotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.

Product Details

Product Type	Protein
Species	Mouse
Source	CHO Cells
Endotoxin Level	<0.06 Eu/µg
Protein Length	Full length protein
Purity	≥98%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.