Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse MCP1 Protein

Cat. No.: IBDP-530422

Size:

Target Information

Sequence QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKRE VCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKS EANASTTFSTTTSSTSVGVTSVTVNHHHHHH
Sequence Similarities Belongs to the intercrine beta (chemokine CC) family.
Amino Acids 24 to 148
Cellular Localization Secreted.
Function Chemotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.

Product Details

Product Type Protein
Species Mouse
Source Mammalian
Tag His
Endotoxin Level <1.0 Eu/µg
Protein Length Full length protein
Molecular Weight 15 kDa
Purity >95%
Active No
Animal free No
Nature Recombinant
Application SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.