Cat. No.: IBDP-531567
Size:
Online InquiryTarget Information
| Synonyms | rMuCCL8, His|||C-C motif chemokine 8|||Ccl8|||Monocyte chemoattractant protein 2|||Monocyte chemotactic protein 2|||MCP-2|||Small-inducible cytokine A8|||Mcp2|||Scya8 |
| Sequence | EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQPHHHHHH |
| Function | MCP-2/CCL8 Protein, Mouse (HEK293, His) is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Mouse (HEK293, His ) is a recombinant mouse MCP-2/CCL8 (E20-P97) protein expressed by HEK293 with a his tag. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 12 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |