Recombinant Mouse Macrophage Inflammatory Protein 3 alpha

Target Information

Sequence	ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCAD PKQNWVKRAVNLLSLRVKKM
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	28 to 97
Cellular Localization	Secreted.
Tissue Specificity	Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate, testis, small intestine and colon.
Function	Chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Possesses antibacterial activity E.coli ATCC 25922 and S.aureus ATCC 29213.

Product Details

Product Type	Protein
Species	Mouse
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Full length protein
Molecular Weight	8 kDa
Purity	≥95%
Active	No
Animal free	Yes
Nature	Recombinant
Application	HPLC, MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.